PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009624737.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 293aa    MW: 33487.6 Da    PI: 6.0437
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009624737.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.61.2e-49101381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF P+deel+++yL kk++++++    ++ evd++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat sgyWkatgkd++vl+ 
  XP_009624737.1  10 LPPGFRFFPSDEELICDYLYKKIANQEVLK-GTLVEVDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYATGFRTNRATISGYWKATGKDRTVLDP 103
                     79*************************655.78***************87788899*************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +g+l+g++ktLvfyk+rap+g kt W+mhe+rle
  XP_009624737.1 104 rTGALIGMRKTLVFYKNRAPNGIKTGWIMHEFRLE 138
                     78889***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-608156IPR003441NAC domain
PROSITE profilePS5100557.20810156IPR003441NAC domain
PfamPF023655.7E-2611137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFFPSD EELICDYLYK KIANQEVLKG TLVEVDLHTC EPWQLPEVAK  60
LNSSEWYFFS FRDRKYATGF RTNRATISGY WKATGKDRTV LDPRTGALIG MRKTLVFYKN  120
RAPNGIKTGW IMHEFRLENP HIPPKEDWVL CRVFHKGTKD DQNNTSNNLS PENMYEASVT  180
SPEFVVSPLN NMDNHGSTMP KLLHYGDGYC PSTANFSSNS AHQNQKSSNF QLSQEINKVL  240
ANDMVHTKCG KEDEFGFLYD MNFEEYSSLQ DGGVHNSCIG DMRFEDENSL VFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-46915616165NO APICAL MERISTEM PROTEIN
1ut4_B2e-46915616165NO APICAL MERISTEM PROTEIN
1ut7_A2e-46915616165NO APICAL MERISTEM PROTEIN
1ut7_B2e-46915616165NO APICAL MERISTEM PROTEIN
3swm_A3e-46915619168NAC domain-containing protein 19
3swm_B3e-46915619168NAC domain-containing protein 19
3swm_C3e-46915619168NAC domain-containing protein 19
3swm_D3e-46915619168NAC domain-containing protein 19
3swp_A3e-46915619168NAC domain-containing protein 19
3swp_B3e-46915619168NAC domain-containing protein 19
3swp_C3e-46915619168NAC domain-containing protein 19
3swp_D3e-46915619168NAC domain-containing protein 19
4dul_A2e-46915616165NAC domain-containing protein 19
4dul_B2e-46915616165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-76HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624737.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE62e-67NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLK4C3L61e-167K4C3L6_SOLLC; Uncharacterized protein
STRINGSolyc06g008360.2.11e-167(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.14e-92NAC domain containing protein 74